PDB entry 2vxr

View 2vxr on RCSB PDB site
Description: crystal structure of the botulinum neurotoxin serotype g binding domain
Class: toxin
Keywords: toxin, hydrolase, neurotoxin, ganglioside, protease, receptor, secreted, botulinum, binding domain, metalloprotease
Deposited on 2008-07-08, released 2009-07-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: botulinum neurotoxin type g
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXR (480-End)
    • Uniprot Q60393 (Start-479)
    Domains in SCOPe 2.05: d2vxra1, d2vxra2
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vxrA (A:)
    mgsshhhhhhssglvprgshmdykdhdgdykdhdidykddddkgtsnissnailslsyrg
    grlidssgygatmnvgsdvifndigngqfklnnsensnitahqskfvvydsmfdnfsinf
    wvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvnaksksiffeys
    ikdnisdyinkwfsititndrlgnaniyingslkksekilnldrinssndidfklinctd
    ttkfvwikdfnifgrelnatevsslywiqsstntlkdfwgnplrydtqyylfnqgmqniy
    ikyfskasmgetaprtnfnnaainyqnlylglrfiikkasnsrninndnivregdyiyln
    idnisdesyrvyvlvnskeiqtqlflapinddptfydvlqikkyyekttyncqilcekdt
    ktfglfgigkfvkdygyvwdtydnyfcisqwylrriseninklrlgcnwqfipvdegwte
    lq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxrA (A:)
    nailslsyrggrlidssgygatmnvgsdvifndigngqfklnnsensnitahqskfvvyd
    smfdnfsinfwvrtpkynnndiqtylqneytiiscikndsgwkvsikgnriiwtlidvna
    ksksiffeysikdnisdyinkwfsititndrlgnaniyingslkksekilnldrinssnd
    idfklinctdttkfvwikdfnifgrelnatevsslywiqsstntlkdfwgnplrydtqyy
    lfnqgmqniyikyfskasmgetaprtnfnnaainyqnlylglrfiikkasnsrninndni
    vregdyiylnidnisdesyrvyvlvnskeiqtqlflapinddptfydvlqikkyyektty
    ncqilcekdtktfglfgigkfvkdywdtydnyfcisqwylrriseninklrlgcnwqfip
    vdegwtel