PDB entry 2vxn

View 2vxn on RCSB PDB site
Description: e65q-tim complexed with phosphoglycolohydroxamate at 0.82 a resolution
Class: isomerase
Keywords: isomerase, fatty acid biosynthesis, transition state analogue, glycolysis, pentose shunt, gluconeogenesis, tim, glycosome, triosephosphate isomerase, enzyme-ligand complex, lipid synthesis, transition state, protonation state
Deposited on 2008-07-08, released 2009-07-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 0.82 Å
R-factor: 0.092
AEROSPACI score: 1.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48499 (Start-250)
      • engineered mutation (65)
    Domains in SCOPe 2.01: d2vxna_
  • Heterogens: PGH, PGA, GOL, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vxnA (A:)
    msakpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpk
    yvisaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackq
    gfmviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvat
    peqaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslk
    pefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxnA (A:)
    akpqpiaaanwkcngttasieklvqvfnehtishdvqcvvaptfvhiplvqaklrnpkyv
    isaqnaiaksgaftgevsmpilkdigvhwvilghserrtyygetdeivaqkvseackqgf
    mviacigetlqqreanqtakvvlsqtsaiaakltkdawnqvvlayepvwaigtgkvatpe
    qaqevhlllrkwvsenigtdvaaklrilyggsvnaanaatlyakpdingflvggaslkpe
    frdiidatr