PDB entry 2vxf

View 2vxf on RCSB PDB site
Description: solution structure of the lsm-domain of zebrafish rap55
Class: transcription
Keywords: lsm proteins, translational repression, transcription, edc3, rap55, car-1, p-bodies, decapping, mRNA decay
Deposited on 2008-07-03, released 2008-09-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lsm14a protein
    Species: Danio rerio [TaxId:7955]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VXF (Start-9)
      • engineered mutation (10)
    • Uniprot Q7SXR4 (10-94)
    Domains in SCOPe 2.04: d2vxfa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vxfA (A:)
    ghhhhhhledpsggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrp
    tdrpiaprdetfeyiifrgsdikdltvceppkpim
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vxfA (A:)
    ledpsggtpyigskisliskaeiryegilytidtenstvalakvrsfgtedrptdrpiap
    rdetfeyiifrgsdikdltvceppkpim