PDB entry 2vxe

View 2vxe on RCSB PDB site
Description: solution structure of the lsm domain of drosophila melanogaster tral (trailer hitch)
Class: transcription
Keywords: edc3, car-1, p-bodies, decapping, mRNA decay, lsm proteins, translational repression, transcription
Deposited on 2008-07-03, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cg10686-pa
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9VTZ0 (4-87)
    • expression tag (0-3)
  Domains in SCOPe 2.08: d2vxea1, d2vxea2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2vxeA (A:)
  gamamsgglpelgskisliskadiryegrlytvdpqectialssvrsfgtedrdtqfqia
  pqsqiydyilfrgsdikdirvvnnhtlp