PDB entry 2vxe

View 2vxe on RCSB PDB site
Description: solution structure of the lsm domain of drosophila melanogaster tral (trailer hitch)
Class: transcription
Keywords: edc3, car-1, p-bodies, decapping, mRNA decay, lsm proteins, translational repression, transcription
Deposited on 2008-07-03, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-07-24, with a file datestamp of 2013-07-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cg10686-pa
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VTZ0 (4-87)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d2vxea1, d2vxea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vxeA (A:)
    gamamsgglpelgskisliskadiryegrlytvdpqectialssvrsfgtedrdtqfqia
    pqsqiydyilfrgsdikdirvvnnhtlp