PDB entry 2vxd

View 2vxd on RCSB PDB site
Description: the structure of the c-terminal domain of nucleophosmin
Deposited on 2008-07-03, released 2008-07-15
The last revision was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleophosmin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06748 (2-53)
      • expression tag (0-1)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2vxdA (A:)
    ggsvedikakmqasiekggslpkveakfinyvkncfrmtdqeaiqdlwqwrksl