PDB entry 2vx9

View 2vx9 on RCSB PDB site
Description: h. salinarum dodecin e45a mutant
Class: flavoprotein
Keywords: flavoprotein, flavin, archaea, dodecin, riboflavin, lumichrome
Deposited on 2008-07-01, released 2009-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.186
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dodecin
    Species: HALOBACTERIUM SALINARUM R1 [TaxId:478009]
    Database cross-references and differences (RAF-indexed):
    • Uniprot B0R5M0
      • engineered mutation (44)
    Domains in SCOPe 2.08: d2vx9a_
  • Heterogens: RBF, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2vx9A (A:)
mvfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigaveertyqtevqv
afeld

    Sequence, based on observed residues (ATOM records): (download) 
    >2vx9A (A:)
vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigaveertyqtevqva
fel