PDB entry 2vwr

View 2vwr on RCSB PDB site
Description: Crystal structure of the second pdz domain of numb-binding protein 2
Class: protein binding
Keywords: protein-binding, metal-binding, ligand of numb protein, zinc, lnx2_human, zinc-finger, polymorphism, ring finger protein 1, casp8 protein-binding, protein binding
Deposited on 2008-06-26, released 2008-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ligand of numb protein x 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VWR (91-94)
      • engineered mutation (4)
    • Uniprot Q8N448 (2-90)
    Domains in SCOPe 2.08: d2vwra1, d2vwra2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vwrA (A:)
    smeilqvalhkrdsgeqlgiklvrrtdepgvfildllegglaaqdgrlssndrvlaingh
    dlkygtpelaaqiiqasgervnltiarpgkpeiel