PDB entry 2vw9

View 2vw9 on RCSB PDB site
Description: single stranded DNA binding protein complex from helicobacter pylori
Class: DNA-binding protein
Keywords: DNA replication, single-stranded DNA, single-stranded DNA binding protein, oligonucleotide/oligosaccharide binding fold, helicobacter pylori, ob-fold, DNA damage, DNA repair, DNA-binding protein
Deposited on 2008-06-18, released 2009-06-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.238
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: single-stranded DNA binding protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vw9a_
  • Chain 'B':
    Compound: single-stranded DNA binding protein
    Species: HELICOBACTER PYLORI [TaxId:85962]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2vw9b_
  • Chain 'C':
    Compound: poly-dt
    Species:
    Gene:
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vw9A (A:)
    mfnkvimvgrltrnvelkylpsgsaaatiglatsrrfkkqdgtlgeevcfidarlfgrta
    eianqylskgssvliegrltyeswmdqtgkknsrhtitadslqfmdkksdnpqanamqds
    imhensnnaypanh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vw9A (A:)
    mfnkvimvgrltrnvelkylpsgsaaatiglatsrrfkkqdgtlgeevcfidarlfgrta
    eianqylskgssvliegrltyeswmdqtgkknsrhtitadslqfmdkks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vw9B (B:)
    mfnkvimvgrltrnvelkylpsgsaaatiglatsrrfkkqdgtlgeevcfidarlfgrta
    eianqylskgssvliegrltyeswmdqtgkknsrhtitadslqfmdkksdnpqanamqds
    imhensnnaypanh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vw9B (B:)
    mfnkvimvgrltrnvelkylpsgsaaatiglatsrrfkkqdgtlgeevcfidarlfgrta
    eianqylskgssvliegrltyeswmdqtgkknsrhtitadslqfmd
    

  • Chain 'C':
    No sequence available.