PDB entry 2vw7

View 2vw7 on RCSB PDB site
Description: nitrite reductase from alcaligenes xylosoxidans - 1 of 3
Class: oxidoreductase
Keywords: nitrite reductase, denitrification, microspectrophotometer, ordered mechanism, oxidoreductase
Deposited on 2008-06-16, released 2008-09-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vw7a1, d2vw7a2
  • Chain 'B':
    Compound: dissimilatory copper-containing nitrite reductase
    Species: ACHROMOBACTER XYLOSOXIDANS [TaxId:85698]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vw7b1, d2vw7b2
  • Heterogens: CU, ZN, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vw7A (A:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vw7A (A:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapipr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vw7B (B:)
    qdadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfng
    smpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfka
    drsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyip
    kgpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihs
    qanrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnh
    nlieafelgaaghikvegkwnddlmkqikapapipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vw7B (B:)
    dadklphtkvtlvappqvhpheqatksgpkvveftmtieekkmviddkgttlqamtfngs
    mpgptlvvhegdyvqltlvnpatnamphnvdfhgatgalggakltnvnpgeqatlrfkad
    rsgtfvyhcapegmvpwhvvsgmsgtlmvlprdglkdpqgkplhydraytigefdlyipk
    gpdgkykdyatlaesygdtvqvmrtltpshivfngkvgaltganaltakvgetvllihsq
    anrdtrphligghgdwvwetgkfanppqrdletwfirggsagaalytfkqpgvyaylnhn
    lieafelgaaghikvegkwnddlmkqikapapip