PDB entry 2vvn

View 2vvn on RCSB PDB site
Description: btgh84 in complex with nh-butylthiazoline
Class: hydrolase
Keywords: glycoside hydrolase, complex, hydrolase, inhibitor, glycosidase
Deposited on 2008-06-10, released 2008-07-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.18252
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: o-glcnacase bt_4395
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vvna1, d2vvna2, d2vvna3
  • Chain 'B':
    Compound: o-glcnacase bt_4395
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vvnb1, d2vvnb2, d2vvnb3
  • Heterogens: GOL, NH4, NHT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vvnA (A:)
    mknnkiyllgacllcavttfaqnvslqpppqqlivqnktidlpavyqlnggeeanphavk
    vlkellsgkqsskkgmlisigekgdksvrkysrqipdhkegyylsvnekeivlagnderg
    tyyalqtfaqllkdgklpeveikdypsvryrgvvegfygtpwshqarlsqlkfygknkmn
    tyiygpkddpyhsapnwrlpypdkeaaqlqelvavanenevdfvwaihpgqdikwnkedr
    dlllakfekmyqlgvrsfavffddisgegtnpqkqaellnyidekfaqvkpdinqlvmcp
    teynkswsnpngnylttlgdklnpsiqimwtgdrvisditrdgiswinerikrpayiwwn
    fpvsdyvrdhlllgpvygndttiakemsgfvtnpmehaesskiaiysvasyawnpakydt
    wqtwkdairtilpsaaeelecfamhnsdlgpnghgyrreesmdiqpaaerflkafkegkn
    ydkadfetlqytfermkesadillmntenkpliveitpwvhqfkltaemgeevlkmvegr
    nesyflrkynhvkalqqqmfyidqtsnqnpyqpgvktatrvikplidrtfatvvkffnqk
    fnahldattdymphkmisnveqiknlplqvkanrvlispanevvkwaagnsveieldaiy
    pgeniqinfgkdapctwgrleistdgkewktvdlkqkesrlsaglqkapvkfvrftnvsd
    eeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vvnA (A:)
    slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
    dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
    ypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdk
    eaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffdd
    isgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnp
    siqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttia
    kemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfam
    hnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadill
    mntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidq
    tsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmlplqvkan
    rvlispveieldaiypgeniqinfrlsaglqkapvkfvrfqfvltiek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vvnB (B:)
    mknnkiyllgacllcavttfaqnvslqpppqqlivqnktidlpavyqlnggeeanphavk
    vlkellsgkqsskkgmlisigekgdksvrkysrqipdhkegyylsvnekeivlagnderg
    tyyalqtfaqllkdgklpeveikdypsvryrgvvegfygtpwshqarlsqlkfygknkmn
    tyiygpkddpyhsapnwrlpypdkeaaqlqelvavanenevdfvwaihpgqdikwnkedr
    dlllakfekmyqlgvrsfavffddisgegtnpqkqaellnyidekfaqvkpdinqlvmcp
    teynkswsnpngnylttlgdklnpsiqimwtgdrvisditrdgiswinerikrpayiwwn
    fpvsdyvrdhlllgpvygndttiakemsgfvtnpmehaesskiaiysvasyawnpakydt
    wqtwkdairtilpsaaeelecfamhnsdlgpnghgyrreesmdiqpaaerflkafkegkn
    ydkadfetlqytfermkesadillmntenkpliveitpwvhqfkltaemgeevlkmvegr
    nesyflrkynhvkalqqqmfyidqtsnqnpyqpgvktatrvikplidrtfatvvkffnqk
    fnahldattdymphkmisnveqiknlplqvkanrvlispanevvkwaagnsveieldaiy
    pgeniqinfgkdapctwgrleistdgkewktvdlkqkesrlsaglqkapvkfvrftnvsd
    eeqqvylrqfvltiekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vvnB (B:)
    slqpppqqlivqnktidlpavyqlnggeeanphavkvlkellsgkqsskkgmlisigekg
    dksvrkysrqipdhkegyylsvnekeivlagndergtyyalqtfaqllkdgklpeveikd
    ypsvryrgvvegfygtpwshqarlsqlkfygknkmntyiygpkddpyhsapnwrlpypdk
    eaaqlqelvavanenevdfvwaihpgqdikwnkedrdlllakfekmyqlgvrsfavffdd
    isgegtnpqkqaellnyidekfaqvkpdinqlvmcpteynkswsnpngnylttlgdklnp
    siqimwtgdrvisditrdgiswinerikrpayiwwnfpvsdyvrdhlllgpvygndttia
    kemsgfvtnpmehaesskiaiysvasyawnpakydtwqtwkdairtilpsaaeelecfam
    hnsdlgpnghgyrreesmdiqpaaerflkafkegknydkadfetlqytfermkesadill
    mntenkpliveitpwvhqfkltaemgeevlkmvegrnesyflrkynhvkalqqqmfyidq
    tsnqnpyqpgvktatrvikplidrtfatvvkffnqkfnahldattdymphkmnlplqvka
    nrvlispveieldaiypgeniqinfrlsaglqkapvkfvrffvltiek