PDB entry 2vvk

View 2vvk on RCSB PDB site
Description: grb2 sh3c (1)
Class: protein-binding
Keywords: grb2 sh3, sh3 domain, sh2 domain, phosphoprotein, host-virus interaction, protein-binding, golgi apparatus, alternative splicing
Deposited on 2008-06-09, released 2009-05-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-23, with a file datestamp of 2009-06-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.16
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVK (0-1)
    • Uniprot P62993 (2-55)
    Domains in SCOPe 2.08: d2vvka1, d2vvka2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vvkA (A:)
    gsvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvn