PDB entry 2vvj

View 2vvj on RCSB PDB site
Description: irisfp fluorescent protein in its red form, cis conformation
Class: fluorescent protein
Keywords: photoactivation, photoconversion, fluorescent protein, optical highlighters, microspectrophotometry, eosfp, photochromism, photoswitching
Deposited on 2008-06-09, released 2008-08-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18853
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVJ
      • chromophore (63)
      • engineered mutation (172)
      • engineered mutation (190)
    • Uniprot Q5S6Z9
    Domains in SCOPe 2.03: d2vvja_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVJ
      • chromophore (63)
      • engineered mutation (172)
      • engineered mutation (190)
    • Uniprot Q5S6Z9
    Domains in SCOPe 2.03: d2vvjb_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVJ (0-1)
      • chromophore (63)
      • engineered mutation (172)
      • engineered mutation (190)
    • Uniprot Q5S6Z9 (2-End)
    Domains in SCOPe 2.03: d2vvjc_
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVJ (Start-1)
      • chromophore (63)
      • engineered mutation (172)
      • engineered mutation (190)
    • Uniprot Q5S6Z9 (2-End)
    Domains in SCOPe 2.03: d2vvjd_
  • Heterogens: SO4, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vvjA (A:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vvjA (A:)
    saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    xnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfhgv
    nfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykakekg
    vklpgyhlvdhcieilshdkdynkvklyehavahsglpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vvjB (B:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vvjB (B:)
    saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    xnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfhgv
    nfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykakekg
    vklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vvjC (C:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vvjC (C:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vvjD (D:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vvjD (D:)
    hmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltt
    afxnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
    gvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykake
    kgvklpgyhlvdhcieilshdkdynkvklyehavahsglpd