PDB entry 2vvi

View 2vvi on RCSB PDB site
Description: irisfp fluorescent protein in its green form, trans conformation
Class: fluorescent protein
Keywords: photoactivation, photoconversion, fluorescent protein, optical highlighters, microspectrophotometry, eosfp, photochromism, photoswitching
Deposited on 2008-06-09, released 2008-11-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-12-09, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1961
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVI
      • engineered mutation (174)
      • engineered mutation (192)
      • chromophore (65)
    • Uniprot Q5S6Z9
    Domains in SCOPe 2.06: d2vvia_
  • Chain 'B':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVI
      • engineered mutation (174)
      • engineered mutation (192)
      • chromophore (65)
    • Uniprot Q5S6Z9
    Domains in SCOPe 2.06: d2vvib_
  • Chain 'C':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVI (0-1)
      • engineered mutation (174)
      • engineered mutation (192)
      • chromophore (65)
    • Uniprot Q5S6Z9 (2-End)
    Domains in SCOPe 2.06: d2vvic1, d2vvic2
  • Chain 'D':
    Compound: green to red photoconvertible gpf-like protein eosfp
    Species: LOBOPHYLLIA HEMPRICHII [TaxId:46758]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VVI
      • engineered mutation (174)
      • engineered mutation (192)
      • chromophore (65)
    • Uniprot Q5S6Z9 (2-End)
    Domains in SCOPe 2.06: d2vvid_
  • Heterogens: SO4, SO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vviA (A:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vviA (A:)
    saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
    gvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykake
    kgvklpgyhlvdhcieilshdkdynkvklyehavahsglp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vviB (B:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vviB (B:)
    saikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilttaf
    hygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrfh
    gvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykake
    kgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vviC (C:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vviC (C:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vviD (D:)
    hhmsaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdilt
    tafhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkv
    rfhgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttyk
    akekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdnarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vviD (D:)
    msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
    fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
    hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
    ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpd