PDB entry 2vvg

View 2vvg on RCSB PDB site
Description: crystal structure of the g.intestinalis kinesin 2 gikin2a motor domain
Class: motor protein
Keywords: motor protein, nucleotide-binding, kinesin motor domain, microtubule, ATP-binding
Deposited on 2008-06-08, released 2008-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-09-29, with a file datestamp of 2009-09-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.2029
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kinesin-2
    Species: Giardia intestinalis [TaxId:5741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vvga_
  • Chain 'B':
    Compound: kinesin-2
    Species: Giardia intestinalis [TaxId:5741]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vvgb_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vvgA (A:)
    mssdnikvivrcrplnaretrenalniirmdeasaqvivdppeqeksatqakkvprtftf
    davydqtscnygifqasfkplidavlegfnstifaygqtgagktwtmggnkeepgaipns
    fkhlfdainssssnqnflvigsylelyneeirdliknntklplkedktrgiyvdglsmhr
    vttaaelsalmdkgfanrhvaatqmndtssrshsifmvriecsevienkevirvgklnlv
    dlagserqsktgatgetlvegakinlslsalglvisklvegathipyrdskltrllqdsl
    ggnsktlmcanispastnydetmstlryadrakqiknkprinedpkdaqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vvgA (A:)
    dnikvivrcrplnaretrenalniirmdeasaqvivdpprtftfdavydqtscnygifqa
    sfkplidavlegfnstifaygqtgagktwtmggnkeepgaipnsfkhlfdainssssnqn
    flvigsylelyneeirdliknntklplkedktrgiyvdglsmhrvttaaelsalmdkgfa
    nrhssrshsifmvriecsevievirvgklnlvdlagserqkinlslsalglvisklvega
    thipyrdskltrllqdslggnsktlmcanispastnydetmstlryadrakqiknkprin
    edpkdaqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vvgB (B:)
    mssdnikvivrcrplnaretrenalniirmdeasaqvivdppeqeksatqakkvprtftf
    davydqtscnygifqasfkplidavlegfnstifaygqtgagktwtmggnkeepgaipns
    fkhlfdainssssnqnflvigsylelyneeirdliknntklplkedktrgiyvdglsmhr
    vttaaelsalmdkgfanrhvaatqmndtssrshsifmvriecsevienkevirvgklnlv
    dlagserqsktgatgetlvegakinlslsalglvisklvegathipyrdskltrllqdsl
    ggnsktlmcanispastnydetmstlryadrakqiknkprinedpkdaqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vvgB (B:)
    dnikvivrcrplnaretrenalniirmdeasaqvivdppeprtftfdavydqtscnygif
    qasfkplidavlegfnstifaygqtgagktwtmggnkeepgaipnsfkhlfdainssssn
    qnflvigsylelyneeirdliknntklplkedktrgiyvdglsmhrvttaaelsalmdkg
    fanrhssrshsifmvriecsevienkevirvgklnlvdlagserqkinlslsalglvisk
    lvegathipyrdskltrllqdslggnsktlmcanispastnydetmstlryadrakqikn
    kprinedpkdaqi