PDB entry 2vv5

View 2vv5 on RCSB PDB site
Description: the open structure of mscs
Class: membrane protein
Keywords: ion transport, transmembrane, inner membrane, membrane structure, membrane protein, membrane, transport, open channel, ionic channel
Deposited on 2008-06-03, released 2008-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: 0.294
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0S2
      • engineered mutation (105)
    Domains in SCOPe 2.06: d2vv5a1, d2vv5a2, d2vv5a3
  • Chain 'B':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0S2
      • engineered mutation (105)
    Domains in SCOPe 2.06: d2vv5b1, d2vv5b2, d2vv5b3
  • Chain 'C':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0S2
      • engineered mutation (105)
    Domains in SCOPe 2.06: d2vv5c1, d2vv5c2, d2vv5c3
  • Chain 'D':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0S2
      • engineered mutation (105)
    Domains in SCOPe 2.06: d2vv5d1, d2vv5d2, d2vv5d3
  • Chain 'E':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0S2
      • engineered mutation (105)
    Domains in SCOPe 2.06: d2vv5e1, d2vv5e2, d2vv5e3
  • Chain 'F':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0S2
      • engineered mutation (105)
    Domains in SCOPe 2.06: d2vv5f1, d2vv5f2, d2vv5f3
  • Chain 'G':
    Compound: Small-conductance mechanosensitive channel
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0C0S2
      • engineered mutation (105)
    Domains in SCOPe 2.06: d2vv5g1, d2vv5g2, d2vv5g3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vv5A (A:)
    medlnvvdsingagswlvanqalllsyavnivaalaiiivgliiarmisnavnrlmisrk
    idatvadflsalvrygiiaftliaalgrvgvqtasviavlgaaglvvglalqgslsnlaa
    gvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiiagniinfsr
    epvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrvw
    snsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrvkedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv5A (A:)
    lsyavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftlia
    algrvgvqtasviavlgaaglvvglalqgslsnlaagvllvmfrpfrageyvdlggvagt
    vlsvqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqi
    ltniiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaa
    gisfpypqmdvnfkrvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vv5B (B:)
    medlnvvdsingagswlvanqalllsyavnivaalaiiivgliiarmisnavnrlmisrk
    idatvadflsalvrygiiaftliaalgrvgvqtasviavlgaaglvvglalqgslsnlaa
    gvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiiagniinfsr
    epvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrvw
    snsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrvkedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv5B (B:)
    lsyavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftlia
    algrvgvqtasviavlgaaglvvglalqgslsnlaagvllvmfrpfrageyvdlggvagt
    vlsvqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqi
    ltniiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaa
    gisfpypqmdvnfkrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vv5C (C:)
    medlnvvdsingagswlvanqalllsyavnivaalaiiivgliiarmisnavnrlmisrk
    idatvadflsalvrygiiaftliaalgrvgvqtasviavlgaaglvvglalqgslsnlaa
    gvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiiagniinfsr
    epvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrvw
    snsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrvkedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv5C (C:)
    lsyavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftlia
    algrvgvqtasviavlgaaglvvglalqgslsnlaagvllvmfrpfrageyvdlggvagt
    vlsvqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqi
    ltniiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaa
    gisfpypqmdvnfkrvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vv5D (D:)
    medlnvvdsingagswlvanqalllsyavnivaalaiiivgliiarmisnavnrlmisrk
    idatvadflsalvrygiiaftliaalgrvgvqtasviavlgaaglvvglalqgslsnlaa
    gvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiiagniinfsr
    epvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrvw
    snsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrvkedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv5D (D:)
    lsyavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftlia
    algrvgvqtasviavlgaaglvvglalqgslsnlaagvllvmfrpfrageyvdlggvagt
    vlsvqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqi
    ltniiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaa
    gisfpypqmdvnfkrvk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vv5E (E:)
    medlnvvdsingagswlvanqalllsyavnivaalaiiivgliiarmisnavnrlmisrk
    idatvadflsalvrygiiaftliaalgrvgvqtasviavlgaaglvvglalqgslsnlaa
    gvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiiagniinfsr
    epvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrvw
    snsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrvkedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv5E (E:)
    lsyavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftlia
    algrvgvqtasviavlgaaglvvglalqgslsnlaagvllvmfrpfrageyvdlggvagt
    vlsvqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqi
    ltniiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaa
    gisfpypqmdvnfkrvk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vv5F (F:)
    medlnvvdsingagswlvanqalllsyavnivaalaiiivgliiarmisnavnrlmisrk
    idatvadflsalvrygiiaftliaalgrvgvqtasviavlgaaglvvglalqgslsnlaa
    gvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiiagniinfsr
    epvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrvw
    snsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrvkedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv5F (F:)
    lsyavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftlia
    algrvgvqtasviavlgaaglvvglalqgslsnlaagvllvmfrpfrageyvdlggvagt
    vlsvqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqi
    ltniiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaa
    gisfpypqmdvnfkrvk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vv5G (G:)
    medlnvvdsingagswlvanqalllsyavnivaalaiiivgliiarmisnavnrlmisrk
    idatvadflsalvrygiiaftliaalgrvgvqtasviavlgaaglvvglalqgslsnlaa
    gvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiiagniinfsr
    epvrrnefiigvaydsdidqvkqiltniiqsedrilkdremtvrlnelgassinfvvrvw
    snsgdlqnvywdvlerikrefdaagisfpypqmdvnfkrvkedkaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vv5G (G:)
    lsyavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftlia
    algrvgvqtasviavlgaaglvvglalqgslsnlaagvllvmfrpfrageyvdlggvagt
    vlsvqifsttmrtadgkiivipngkiiagniinfsrepvrrnefiigvaydsdidqvkqi
    ltniiqsedrilkdremtvrlnelgassinfvvrvwsnsgdlqnvywdvlerikrefdaa
    gisfpypqmdvnfkrvk