PDB entry 2vuz

View 2vuz on RCSB PDB site
Description: crystal structure of codakine in complex with biantennary nonasaccharide at 1.7a resolution
Deposited on 2008-06-02, released 2008-08-05
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: codakine
    Species: CODAKIA ORBICULARIS [TaxId:13016]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q3KVL7 (0-128)
      • conflict (53)
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2vuzA (A:)
gcpdgwtqfldlcyiyqsakaswasaqsscqalggilaepdtacenevlihmckengdag
sfgpwlggqkvggawqwsssgaafdylrwgpnepnnsggnedclhynwlswndlrchyqa
sylcqraae