PDB entry 2vuu

View 2vuu on RCSB PDB site
Description: crystal structure of nadp-bound nmra-area zinc finger complex
Class: transcription
Keywords: transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation, zinc-finger, DNA-binding, zinc fingers, transcription, zinc, area, nmra, nucleus, activator, gata-type
Deposited on 2008-05-30, released 2008-07-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.232
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.02: d2vuua_
  • Chain 'B':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.02: d2vuub_
  • Chain 'C':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.02: d2vuuc_
  • Chain 'D':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.02: d2vuud_
  • Chain 'E':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.02: d2vuue_
  • Chain 'F':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.02: d2vuuf_
  • Chain 'G':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.02: d2vuug_
  • Chain 'H':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.02: d2vuuh_
  • Chain 'I':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vuui1
  • Chain 'J':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vuuj1
  • Chain 'K':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vuuk1
  • Chain 'L':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vuul1
  • Chain 'M':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vuum1
  • Chain 'N':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vuun1
  • Chain 'O':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vuuo1
  • Chain 'P':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d2vuup1
  • Heterogens: NAP, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vuuA (A:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuA (A:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vuuB (B:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuB (B:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrrvtdearklwsgwrdmee
    yarevfpieeeangldwml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vuuC (C:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuC (C:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vuuD (D:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuD (D:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrrvtdearklwsgwrdmee
    yarevfpieeeangldwml
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vuuE (E:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuE (E:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vuuF (F:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuF (F:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vuuG (G:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuG (G:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrrvtdearklwsgwrdmee
    yarevfpieeeangldwml
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vuuH (H:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuH (H:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsqrvtdearklwsgwrdmee
    yarevfpieeeangldwml
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vuuI (I:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuI (I:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vuuJ (J:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuJ (J:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vuuK (K:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuK (K:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vuuL (L:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuL (L:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2vuuM (M:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuM (M:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2vuuN (N:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuN (N:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2vuuO (O:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuO (O:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrpls
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2vuuP (P:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuuP (P:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl