PDB entry 2vut

View 2vut on RCSB PDB site
Description: crystal structure of nad-bound nmra-area zinc finger complex
Class: transcription
Keywords: transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation, zinc-finger, DNA-binding, zinc fingers, transcription, zinc, area, nmra, nucleus, activator, gata-type
Deposited on 2008-05-30, released 2008-07-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.215
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vuta_
  • Chain 'B':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vutb_
  • Chain 'C':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vutc_
  • Chain 'D':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vutd_
  • Chain 'E':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vute_
  • Chain 'F':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vutf_
  • Chain 'G':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vutg_
  • Chain 'H':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vuth_
  • Chain 'I':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vuti_
  • Chain 'J':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vutj_
  • Chain 'K':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vutk_
  • Chain 'L':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vutl_
  • Chain 'M':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vutm_
  • Chain 'N':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vutn_
  • Chain 'O':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vuto_
  • Chain 'P':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vutp_
  • Heterogens: NAD, CL, GOL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vutA (A:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutA (A:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vutB (B:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutB (B:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrqrvtdearklwsgwrdme
    eyarevfpieeeangldwml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vutC (C:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutC (C:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vutD (D:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutD (D:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrqrvtdearklwsgwrdme
    eyarevfpieeeangldwml
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vutE (E:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutE (E:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vutF (F:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutF (F:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vutG (G:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutG (G:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrrvtdearklwsgwrdmee
    yarevfpieeeangldwml
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vutH (H:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutH (H:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsqrvtdearklwsgwrdmee
    yarevfpieeeangldwml
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vutI (I:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutI (I:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vutJ (J:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutJ (J:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vutK (K:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutK (K:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrpls
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vutL (L:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutL (L:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2vutM (M:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutM (M:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2vutN (N:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutN (N:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2vutO (O:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutO (O:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrpls
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2vutP (P:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vutP (P:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl