PDB entry 2vus

View 2vus on RCSB PDB site
Description: crystal structure of unliganded nmra-area zinc finger complex
Class: transcription
Keywords: transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation, zinc-finger, DNA-binding, zinc fingers, transcription, zinc, area, nmra, nucleus, activator, gata-type
Deposited on 2008-05-30, released 2008-07-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.242
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vusa_
  • Chain 'B':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vusb_
  • Chain 'C':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vusc_
  • Chain 'D':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vusd_
  • Chain 'E':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vuse_
  • Chain 'F':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vusf_
  • Chain 'G':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vusg_
  • Chain 'H':
    Compound: nitrogen metabolite repression regulator nmra
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O59919 (Start-351)
      • conflict (237)
    Domains in SCOPe 2.03: d2vush_
  • Chain 'I':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vusi_
  • Chain 'J':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vusj_
  • Chain 'K':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vusk_
  • Chain 'L':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vusl_
  • Chain 'M':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vusm_
  • Chain 'N':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vusn_
  • Chain 'O':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vuso_
  • Chain 'P':
    Compound: nitrogen regulatory protein area
    Species: Emericella nidulans [TaxId:162425]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2vusp_
  • Heterogens: SO4, CL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vusA (A:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusA (A:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vusB (B:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusB (B:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vusC (C:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusC (C:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vusD (D:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusD (D:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2vusE (E:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusE (E:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vusF (F:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusF (F:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2vusG (G:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusG (G:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vusH (H:)
    maqqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgpl
    lnnvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslyg
    pwpavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhap
    fdpdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrv
    tyvqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrpaagspkglgpangkg
    agagmmqgpggvisqrvtdearklwsgwrdmeeyarevfpieeeangldwml
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusH (H:)
    qqkktiavvnatgrqaaslirvaaavghhvraqvhslkgliaeelqaipnvtlfqgplln
    nvplmdtlfegahlafinttsqagdeiaigkdladaakragtiqhyiyssmpdhslygpw
    pavpmwapkftvenyvrqlglpstfvyagiynnnftslpyplfqmelmpdgtfewhapfd
    pdiplpwldaehdvgpallqifkdgpqkwnghrialtfetlspvqvcaafsralnrrvty
    vqvpkveikvnipvgyreqleaievvfgehkapyfplpefsrvtdearklwsgwrdmeey
    arevfpieeeangldwml
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2vusI (I:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusI (I:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vusJ (J:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusJ (J:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vusK (K:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusK (K:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrpls
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vusL (L:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusL (L:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vusM (M:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2vusN (N:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusN (N:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2vusO (O:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusO (O:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrpls
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2vusP (P:)
    pttctncftqttplwrrnpegqplcnacglflklhgvvrplsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vusP (P:)
    ttctncftqttplwrrnpegqplcnacglflklhgvvrplsl