PDB entry 2vum

View 2vum on RCSB PDB site
Description: alpha-amanitin inhibited complete RNA polymerase II elongation complex
Class: transferase/toxin
Keywords: transferase-toxin complex, alpha amanitin, toxin, inhibitor, polymerase, transferase, DNA binding, zinc-finger, phosphoprotein, transcription, ubl transcription-toxin complex
Deposited on 2008-05-27, released 2008-06-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-07.
Experiment type: XRAY
Resolution: 3.4 Å
R-factor: 0.2547
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase II subunit RPB1
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vuma1
  • Chain 'B':
    Compound: DNA-directed RNA polymerase II subunit RPB2
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vumb1
  • Chain 'C':
    Compound: DNA-directed RNA polymerase II subunit RPB3
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: DNA-directed RNA polymerase II subunit RPB4
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vumd1
  • Chain 'E':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC1
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC2
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vumf1
  • Chain 'G':
    Compound: DNA-directed RNA polymerase II subunit RPB7
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vumg1
  • Chain 'H':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC3
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vumh1
  • Chain 'I':
    Compound: DNA-directed RNA polymerase II subunit RPB9
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC5
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vumj1
  • Chain 'K':
    Compound: DNA-directed RNA polymerase II subunit RPB11
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vumk1
  • Chain 'L':
    Compound: DNA-directed RNA polymerases I, II, and III subunit RPABC4
    Species: SACCHAROMYCES CEREVISIAE [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2vuml1
  • Chain 'M':
    Compound: alpha-amanitin
    Species: AMANITA PHALLOIDES [TaxId:67723]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 5'-d(*ap*ap*ap*cp*tp*ap*cp*tp*tp*gp*ap*gp*cp*t)-3'
    Species: synthetic, synthetic
    Gene:
  • Chain 'P':
    Compound: 5'-r(*ap*ap*ap*gp*ap*cp*cp*ap*gp*gp*c)-3'
    Species: synthetic, synthetic
    Gene:
  • Chain 'T':
    Compound: 5'-d(*ap*gp*cp*tp*cp*ap*ap*gp*tp*ap *gp*tp*tp*ap*cp*gp*cp*cp*brup*gp*gp*tp*cp*ap*tp*t)-3'
    Species: synthetic, synthetic
    Gene:
  • Heterogens: ZN, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vumA (A:)
    mvgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgs
    idrnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehne
    lmrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglk
    lvgswkkdratgdadepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclp
    vppppvrpsisfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhv
    atymdndiagqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnle
    ldqvgvpksiaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskr
    agdiqlqygwkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspyna
    dfdgdemnlhvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtf
    ieldqvlnmlywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllsp
    kdngmliidgqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhn
    gfstgigdtiadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvr
    flneardkagrlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfv
    drtlphfskddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrr
    lvkaledimvhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvd
    llntdhtldpsllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvni
    rriiqnaqqtfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfcc
    llrsrlatrrvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmt
    lntfhfagvaskkvtsgvprlkeilnvaknmktpsltvylepghaadqeqaklirsaieh
    ttlksvtiaseiyydpdprstvipedeeiiqlhfslldeeaeqsfdqqspwllrleldra
    amndkdltmgqvgerikqtfkndlfviwsedndekliircrvvrpksldaeteaeedhml
    kkientmlenitlrgveniervvmmkydrkvpsptgeyvkepewvletdgvnlsevmtvp
    gidptriytnsfidimevlgieagraalykevynviasdgsyvnyrhmallvdvmttqgg
    ltsvtrhgfnrsntgalmrcsfeetveilfeagasaelddcrgvsenvilgqmapigtga
    fdvmideeslvkympeqkiteiedgqdggvtpysnesglvnadldvkdelmfsplvdsgs
    ndamaggftayggadygeatspfgaygeaptspgfgvsspgfsptsptysptspayspts
    psysptspsysptspsysptspsysptspsysptspsysptspsysptspsysptspsys
    ptspsysptspsysptspsysptspsysptspsysptspaysptspsysptspsysptsp
    sysptspsysptspnysptspsysptspgyspgspayspkqdeqkhnenensr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vumA (A:)
    vgqqyssaplrtvkevqfglfspeevraisvakirfpetmdetqtrakigglndprlgsi
    drnlkcqtcqegmnecpghfghidlakpvfhvgfiakikkvcecvcmhcgkllldehnel
    mrqalaikdskkrfaaiwtlcktkmvcetdvpseddptqlvsrggcgntqptirkdglkl
    vgswkdepelrvlsteeilnifkhisvkdftslgfnevfsrpewmiltclpvppppvrps
    isfnesqrgeddltfkladilkanisletlehngaphhaieeaesllqfhvatymdndia
    gqpqalqksgrpvksirarlkgkegrirgnlmgkrvdfsartvisgdpnleldqvgvpks
    iaktltypevvtpynidrltqlvrngpnehpgakyvirdsgdridlryskragdiqlqyg
    wkverhimdndpvlfnrqpslhkmsmmahrvkvipystfrlnlsvtspynadfdgdemnl
    hvpqseetraelsqlcavplqivspqsnkpcmgivqdtlcgirkltlrdtfieldqvlnm
    lywvpdwdgviptpaiikpkplwsgkqilsvaipngihlqrfdegttllspkdngmliid
    gqiifgvvekktvgssngglihvvtrekgpqvcaklfgniqkvvnfwllhngfstgigdt
    iadgptmreitetiaeakkkvldvtkeaqanlltakhgmtlresfednvvrflneardka
    grlaevnlkdlnnvkqmvmagskgsfiniaqmsacvgqqsvegkriafgfvdrtlphfsk
    ddyspeskgfvensylrgltpqefffhamggreglidtavktaetgyiqrrlvkaledim
    vhydnttrnslgnviqfiygedgmdaahiekqsldtiggsdaafekryrvdllntdhtld
    psllesgseilgdlklqvlldeeykqlvkdrkflrevfvdgeanwplpvnirriiqnaqq
    tfhidhtkpsdltikdivlgvkdlqenllvlrgkneiiqnaqrdavtlfccllrsrlatr
    rvlqeyrltkqafdwvlsnieaqflrsvvhpgemvgvlaaqsigepatqmtlntfhvtsg
    vprlkeilnvaknmktpsltvylepghaadqeqaklirsaiehttlksvtiaseiyydpd
    prstvipedeeiiqlhfslqqspwllrleldraamndkdltmgqvgerikqtfkndlfvi
    wsedndekliircrvvaeedhmlkkientmlenitlrgveniervvmmkydrkvpsptge
    yvkepewvletdgvnlsevmtvpgidptriytnsfidimevlgieagraalykevynvia
    sdgsyvnyrhmallvdvmttqggltsvtrhgfnrsntgalmrcsfeetveilfeagasae
    lddcrgvsenvilgqmapigtgafdvmideeslvkymp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vumB (B:)
    msdlansekyydedpygfedesapitaedswavisaffrekglvsqqldsfnqfvdytlq
    diicedstlileqlaqhttesdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlr
    nltyssglfvdvkkrtyeaidvpgrelkyeliaeeseddsesgkvfigrlpimlrskncy
    lseatesdlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaei
    rsalekgsrfistlqvklygregssartikatlpyikqdipiviifralgiipdgeileh
    icydvndwqmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkef
    lphitqlegfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktl
    fkkltkdifrymqrtveeahdfnmklainaktitsglkyalatgnwgeqkkamssragvs
    qvlnrytysstlshlrrtntpigrdgklakprqlhnthwglvcpaetpegqacglvknls
    lmscisvgtdpmpiitflsewgmepledyvphqspdatrvfvngvwhgvhrnparlmetl
    rtlrrkgdinpevsmirdirekelkiftdagrvyrplfiveddeslghkelkvrkghiak
    lmateyqdieggfedveeytwssllneglveyidaeeeesiliamqpedlepaeaneend
    ldvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgv
    fltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaivaiacysgynqedsmi
    mnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrmkhgtydkldddglia
    pgvrvsgedviigkttpispdeeelgqrtayhskrdastplrstengivdqvlvttnqdg
    lkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaipsr
    mtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtgkk
    lmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdcmia
    hgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaa
    kllfqelmamnitprlytdrsrdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vumB (B:)
    desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliisfgkiyvt
    kpmvnesdgvthalypqearlrnltyssglfvdvkkkvfigrlpimlrskncylseates
    dlyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekg
    srfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvnd
    wqmlemlkpcvedgfviqdretaldfigkekriqyakdilqkeflphitqlegfesrkaf
    flgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtv
    elainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtntpiak
    prqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgmepledyv
    phqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdirekelkiftda
    grvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglveyidaeeee
    siliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiipfpdhnqsp
    rntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelpagqnaiv
    aiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpqrtntlrm
    khgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdqvlvttnq
    dglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdliinphaip
    srmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfevmynghtg
    kklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfgemerdcm
    iahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidiyqihipy
    aakllfqelmamnitprlytdrsrdf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vumD (D:)
    mnvststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvik
    ealverrrafkrsqkkhkkkhlkhenandettavededddldeddvnaddddfmhsetre
    kelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgaviqllkstglhpfevaql
    gslacdtadeaktlipslnnkisddelerilkelsnletly
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vumD (D:)
    ststfqtrrrrlkkveeeenaatlqlgqefqlkqinhqgeeeelialnlsearlvikeal
    verrrafkrsqkktrekelesidvlleqttggnnkdlkntmqyltnfsrfrdqetvgavi
    qllkstglhpfevaqlgslacdtadeaktlipslnnkisddelerilkelsnletly
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2vumF (F:)
    msdyeeafndgnenfedfdvehfsdeetyeekpqfkdgettdangktivtggngpedfqq
    heqirrktlkekaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplri
    amkelaekkiplvirrylpdgsfedwsveelivdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vumF (F:)
    kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
    lvirrylpdgsfedwsveelivdl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vumG (G:)
    mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
    ilptdgsaefnvkyravvfkpfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdlt
    fnagsnppsyqssedvitiksrirvkiegcisqvssihaigsikedylgai
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2vumH (H:)
    msntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtia
    sslnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfgg
    llmrlegnyrnlnnlkqenayllirr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vumH (H:)
    sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias
    sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln
    nlkqenayllirr
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2vumJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynplekrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vumJ (J:)
    mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
    lrynp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2vumK (K:)
    mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
    ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtlaaddaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vumK (K:)
    mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
    ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2vumL (L:)
    msregfqiptnldaaaagtsqartatlkyicaecssklslsrtdavrckdcghrillkar
    tkrlvqfear
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vumL (L:)
    atlkyicaecssklslsrtdavrckdcghrillkartkrlvqfear
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.