PDB entry 2vul

View 2vul on RCSB PDB site
Description: Thermostable mutant of ENVIRONMENTALLY ISOLATED GH11 XYLANASE
Class: hydrolase
Keywords: gh11, xylanase, hydrolase, glycosidase
Deposited on 2008-05-27, released 2008-06-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.153
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gh11 xylanase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VUL
    Domains in SCOPe 2.05: d2vula_
  • Heterogens: SO4, 12P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vulA (A:)
    mislkrvaallcvaglgmsaanaqtcltspqtgfhngffysfwkdspgtvnfclleggry
    tsnwsginnwvggkgwqtgsrrnitysgsfntpgngylalygwttnplveyyvvdswgsw
    rppgsdgtflgtvnsdggtydiyraqrvnapsiignatfyqywsvrqskrvggtittgnh
    fdawasvglnlgthnyqimategyqssgssditvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vulA (A:)
    aqtcltspqtgfhngffysfwkdspgtvnfclleggrytsnwsginnwvggkgwqtgsrr
    nitysgsfntpgngylalygwttnplveyyvvdswgswrppgsdgtflgtvnsdggtydi
    yraqrvnapsiignatfyqywsvrqskrvggtittgnhfdawasvglnlgthnyqimate
    gyqssgssditvs