PDB entry 2vuj

View 2vuj on RCSB PDB site
Description: environmentally isolated gh11 xylanase
Class: hydrolase
Keywords: gh11, xylanase, hydrolase, glycosidase
Deposited on 2008-05-26, released 2008-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.188
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gh11 xylanase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VUJ (Start-218)
    Domains in SCOPe 2.07: d2vuja_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vujA (A:)
    mislkrvaallcvaglgmsaanaqtcltssqtgtnngfyysfwkdspgtvnfclqsggry
    tsnwsginnwvggkgwqtgsrrnitysgsfnspgngylalygwttnplveyyvvdswgsw
    rppgsdgtflgtvnsdggtydiyraqrvnapsiignatfyqywsvrqskrvggtittgnh
    fdawasvglnlgthnyqimategyqssgssditvseggg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vujA (A:)
    qtcltssqtgtnngfyysfwkdspgtvnfclqsggrytsnwsginnwvggkgwqtgsrrn
    itysgsfnspgngylalygwttnplveyyvvdswgswrppgsdgtflgtvnsdggtydiy
    raqrvnapsiignatfyqywsvrqskrvggtittgnhfdawasvglnlgthnyqimateg
    yqssgssditvseggg