PDB entry 2vui

View 2vui on RCSB PDB site
Description: crystal structure of the hupr receiver domain in inhibitory phospho-state
Class: DNA-binding
Keywords: nucleotide-binding, transcription regulation, beryllium fluoride phosphorylation mimic, hupr, activator, cytoplasm, ATP-binding, DNA-binding, two-component regulatory system, transcription, phosphoprotein, response regulator
Deposited on 2008-05-26, released 2008-11-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.2609
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: hydrogenase transcriptional regulatory protein hupr1
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26408 (0-135)
    • PDB 2VUI (136-End)
    Domains in SCOPe 2.08: d2vuib_
  • Heterogens: BEF, MG

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vuiB (B:)
    apaillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviicdqrmpgrtgv
    dfltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmf
    tlarenerlslemrllerp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vuiB (B:)
    apaillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviicdqrmpgrtgv
    dfltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmf
    tlarenerlslemrlle