PDB entry 2vuh

View 2vuh on RCSB PDB site
Description: crystal structure of the d55e mutant of the hupr receiver domain
Class: DNA-binding
Keywords: nucleotide-binding, transcription regulation, beryllium fluoride phosphorylation mimic, hupr, activator, cytoplasm, ATP-binding, DNA-binding, two-component regulatory system, transcription, phosphoprotein, response regulator
Deposited on 2008-05-26, released 2008-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.22204
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: hydrogenase transcriptional regulatory protein hupr1
    Species: RHODOBACTER CAPSULATUS [TaxId:1061]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26408 (0-End)
      • engineered mutation (50)
    • PDB 2VUH
    Domains in SCOPe 2.07: d2vuhb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2vuhB (B:)
apaillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviiceqrmpgrtgv
dfltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmf
tlarenerlslemrllerp

    Sequence, based on observed residues (ATOM records): (download) 
    >2vuhB (B:)
apaillvddephslaamklaleddfdvltaqgaeaaiaileeewvqviiceqrmpgrtgv
dfltevrerwpetvriiitgytdsasmmaaindagihqfltkpwhpeqllssarnaarmf
tlarenerlslemrl