PDB entry 2vu8

View 2vu8 on RCSB PDB site
Description: crystal structure of an insect inhibitor with a fungal trypsin
Deposited on 2008-05-21, released 2008-12-23
The last revision was dated 2008-12-23, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.2
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Trypsin
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: pacifastin-related serine protease inhibitor
    Species: LOCUSTA MIGRATORIA, synthetic [TaxId:7004]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >2vu8E (E:)
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records:
    >2vu8I (I:)
ectpgqtkkqdcntctctptgiwgctrkacrtt