PDB entry 2vu5

View 2vu5 on RCSB PDB site
Description: crystal structure of pndk from bacillus anthracis
Class: transferase
Keywords: bacillus anthracis, nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, nucleoside diphosphate kinase, kinase, cytoplasm, magnesium, transferase
Deposited on 2008-05-21, released 2009-03-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-07-14, with a file datestamp of 2009-07-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.17707
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nucleoside diphosphate kinase
  Species: Bacillus anthracis [TaxId:1392]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q81SV8 (0-147)
    • conflict (52)
  Domains in SCOPe 2.03: d2vu5a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2vu5A (A:)
  mektflmvkpdgvqrafigeivarfekkgfqlvgaklmqvtpeiagqhyaeheekpffge
  lvdfitsgpvfamvwqgegvvdtarnmmgktrpheaapgtirgdfgvtvakniihgsdsl
  esaereigiffkeeelvdysklmnewiy