PDB entry 2vu2

View 2vu2 on RCSB PDB site
Description: biosynthetic thiolase from z. ramigera. complex with s-pantetheine-11-pivalate.
Class: transferase
Keywords: acyltransferase, phb biosynthesis, transferase, thiolase fold
Deposited on 2008-05-19, released 2008-10-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.23331
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA acetyltransferase
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (11-391)
      • conflict (128)
    • PDB 2VU2 (10-10)
    Domains in SCOPe 2.06: d2vu2a1, d2vu2a2
  • Chain 'B':
    Compound: Acetyl-CoA acetyltransferase
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (11-391)
      • conflict (128)
    • PDB 2VU2 (10-10)
    Domains in SCOPe 2.06: d2vu2b1, d2vu2b2
  • Chain 'C':
    Compound: Acetyl-CoA acetyltransferase
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (11-391)
      • conflict (128)
    • PDB 2VU2 (10-10)
    Domains in SCOPe 2.06: d2vu2c1, d2vu2c2
  • Chain 'D':
    Compound: Acetyl-CoA acetyltransferase
    Species: ZOOGLOEA RAMIGERA [TaxId:350]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07097 (11-391)
      • conflict (128)
    • PDB 2VU2 (10-10)
    Domains in SCOPe 2.06: d2vu2d1, d2vu2d2
  • Heterogens: PN5, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vu2A (A:)
    stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
    gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
    maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
    asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
    vtagnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkal
    eragwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilnt
    llfemkrrgarkglatlcigggmgvamciesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vu2A (A:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vu2B (B:)
    stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
    gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
    maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
    asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
    vtagnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkal
    eragwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilnt
    llfemkrrgarkglatlcigggmgvamciesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vu2B (B:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2vu2C (C:)
    stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
    gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
    maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
    asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
    vtagnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkal
    eragwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilnt
    llfemkrrgarkglatlcigggmgvamciesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vu2C (C:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2vu2D (D:)
    stpsiviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpa
    gegqnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesms
    maphcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafav
    asqnkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegt
    vtagnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkal
    eragwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilnt
    llfemkrrgarkglatlcigggmgvamciesl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vu2D (D:)
    siviasaartavgsfngafantpahelgatvisavleragvaagevnevilgqvlpageg
    qnparqaamkagvpqeatawgmnqlcgsglravalgmqqiatgdasiivaggmesmsmap
    hcahlrggvkmgdfkmidtmikdgltdafygyhmgttaenvakqwqlsrdeqdafavasq
    nkaeaaqkdgrfkdeivpfivkgrkgditvdadeyirhgatldsmaklrpafdkegtvta
    gnasglndgaaaallmseaeasrrgiqplgrivswatvgvdpkvmgtgpipasrkalera
    gwkigdldlveaneafaaqacavnkdlgwdpsivnvnggaiaighpigasgarilntllf
    emkrrgarkglatlcigggmgvamciesl