PDB entry 2vt8

View 2vt8 on RCSB PDB site
Description: structure of a conserved dimerisation domain within fbox7 and pi31
Deposited on 2008-05-12, released 2008-05-20
The last revision was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proteasome inhibitor pi31 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VT8 (0-1)
      • engineered mutation (37)
    • Uniprot Q92530 (2-End)
  • Chain 'B':
    Compound: proteasome inhibitor pi31 subunit
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VT8 (Start-1)
      • engineered mutation (37)
    • Uniprot Q92530 (2-End)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2vt8A (A:)
    shmaglevlfasaapaitcrqdalvcflhwevvthgycglgvgdqpgpndkksellpagw
    nnnkdlyvlryeykdgsrkllvkaitvessmilnvleygsqqvadltlnlddyidaehlg
    dfhrtyknseelrsrivsgiitpiheqwekanv
    

    Sequence, based on observed residues (ATOM records):
    >2vt8A (A:)
    shmaglevlfasaapaitcrqdalvcflhwevvthgycglgvgdqpgpndkksellpagw
    nnnkdlyvlryeykdgrkllvkaitvessmilnvleygsqqvadltlnlddyidaehlgd
    fhrtyknseelrsrivsgiitpi
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2vt8B (B:)
    shmaglevlfasaapaitcrqdalvcflhwevvthgycglgvgdqpgpndkksellpagw
    nnnkdlyvlryeykdgsrkllvkaitvessmilnvleygsqqvadltlnlddyidaehlg
    dfhrtyknseelrsrivsgiitpiheqwekanv
    

    Sequence, based on observed residues (ATOM records):
    >2vt8B (B:)
    hmaglevlfasaapaitcrqdalvcflhwevvthgycglgvgdqpgpndkksellpagwn
    nnkdlyvlryeykdgsrkllvkaitvessmilnvleygsqqvadltlnlddyidaehlgd
    fhrtyknseelrsrivsgiitpi