PDB entry 2vsx

View 2vsx on RCSB PDB site
Description: Crystal Structure of a Translation Initiation Complex
Class: translation/hydrolase
Keywords: ACETYLATION, ATP-BINDING, PHOSPHOPROTEIN, PROTEIN BIOSYNTHESIS, TRANSLATION REGULATION, TRANSLATION INITIATION, TRANSLATION/HYDROLASE, INITIATION FACTOR, NUCLEOTIDE-BINDING, HELICASE, HYDROLASE, CYTOPLASM, RNA-BINDING, TRANSLATION-HYDROLASE complex
Deposited on 2008-04-30, released 2008-06-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent RNA helicase eif4a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2vsxa1, d2vsxa2
  • Chain 'B':
    Compound: ATP-dependent RNA helicase eif4a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2vsxb1, d2vsxb2
  • Chain 'E':
    Compound: Eukaryotic initiation factor 4F subunit p150
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Eukaryotic initiation factor 4F subunit p150
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vsxA (A:)
    msegitdieesqiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiiegh
    dvlaqaqsgtgktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdik
    vhaciggtsfvedaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgf
    keqiyqiftllppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvn
    veeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerd
    timkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggrfgrkgva
    infvtnedvgamrelekfystqieelpsdiatlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vsxA (A:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciglrdaq
    ivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllppttqvvlls
    atmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnveeeeykyecltdlydsisvt
    qavifcntrrkveelttklrndkftvsaiysdlpqqerdtimkefrsgssrilistdlla
    rgidvqqvslvinydlpankenyihrigrkgvainfvtnedvgamrelekfystqieelp
    sdiatl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vsxB (B:)
    msegitdieesqiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiiegh
    dvlaqaqsgtgktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdik
    vhaciggtsfvedaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgf
    keqiyqiftllppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvn
    veeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerd
    timkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggrfgrkgva
    infvtnedvgamrelekfystqieelpsdiatlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vsxB (B:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciglrdaq
    ivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftllppttqvvlls
    atmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnveeeeykyecltdlydsisvt
    qavifcntrrkveelttklrndkftvsaiysdlpqqerdtimkefrsgssrilistdlla
    rgidvqqvslvinydlpankenyihrigrkgvainfvtnedvgamrelekfystqieelp
    sdiatl
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.