PDB entry 2vsm

View 2vsm on RCSB PDB site
Description: Nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinB2
Class: hydrolase
Keywords: developmental protein, henipavirus, neurogenesis, glycoprotein, paramyxovirus, envelope protein, cell surface receptor, hendra, virion, ephrin, complex, membrane, hydrolase, b2, efn, niv, eph, hev, hev-g, nipah, virus, niv-g, phosphoprotein, differentiation, viral attachment, signal-anchor, hemagglutinin, transmembrane
Deposited on 2008-04-25, released 2008-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemagglutinin-neuraminidase
  Species: NIPAH VIRUS, synthetic [TaxId:121791]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9IH62 (0-414)
  • PDB 2VSM (415-415)
• Chain 'B':
  Compound: ephrin-b2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P52799 (0-137)
  • PDB 2VSM (138-139)
  Domains in SCOPe 2.08: d2vsmb1, d2vsmb2
• Heterogens: IPA, NAG, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence, based on SEQRES records: (download)
  

  >2vsmB (B:)
  ivlepiywnssnskflpgqglvlypqigdkldiicpkvdsktvgqyeyykvymvdkdqad
  rctikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldn
  qeggvcqtramkilmkvghh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2vsmB (B:)
  ivlepiywnssnskflpgqglvlypqigdkldiicpkvdvgqyeyykvymvdkdqadrct
  ikkentpllncakpdqdikftikfqefspnlwglefqknkdyyiistsngslegldnqeg
  gvcqtramkilmkvghh