PDB entry 2vsd

View 2vsd on RCSB PDB site
Description: crystal structure of chir-ab1
Deposited on 2008-04-22, released 2008-07-29
The last revision was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chir ab1
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5ZJ90 (Start-94)
      • conflict (4)
      • conflict (20)
      • conflict (45)
      • conflict (84-85)
    • PDB 2VSD
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2vsdA (A:)
    qqlpqpslslhpsqgvslgdtvtlrchlprmaawvqlwlngtlrfdkekdkeqdaaefsf
    avtnledagtyqcryqvseplwtsnqsdpvelvltiegrhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >2vsdA (A:)
    lpqpslslhpsqgvslgdtvtlrchlprmaawvqlwlngtlrfdkekdkeqdaaefsfav
    tnledagtyqcryqvseplwtsnqsdpvelvlt