PDB entry 2vs3

View 2vs3 on RCSB PDB site
Description: THE BINDING OF UDP-GALACTOSE BY AN ACTIVE SITE MUTANT OF alpha-1,3 GALACTOSYLTRANSFERASE (alpha3GT)
Class: transferase
Keywords: manganese, transferase, glycoprotein, metal-binding, active-site mutant, glycosyltransferase, n-acetyl lactosamine, signal-anchor, transmembrane, golgi apparatus, gt, udp, membrane, alpha3gt, galactose, alpha-3gt
Deposited on 2008-04-18, released 2008-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: n-acetyllactosaminide alpha-1,3-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14769 (Start-288)
      • engineered mutation (236)
    Domains in SCOPe 2.08: d2vs3a_
  • Chain 'B':
    Compound: n-acetyllactosaminide alpha-1,3-galactosyltransferase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14769 (Start-288)
      • engineered mutation (236)
    Domains in SCOPe 2.08: d2vs3b_
  • Heterogens: UDP, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vs3A (A:)
    esklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgry
    iehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdis
    mmrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndft
    yerrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhnesh
    lnkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vs3A (A:)
    klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
    hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
    rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
    rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhneshln
    kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vs3B (B:)
    esklklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgry
    iehyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdis
    mmrmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndft
    yerrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhnesh
    lnkyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vs3B (B:)
    klklsdwfnpfkrpevvtmtkwkapvvwegtynravldnyyakqkitvgltvfavgryie
    hyleefltsankhfmvghpvifyimvddvsrmplielgplrsfkvfkikpekrwqdismm
    rmktigehivahiqhevdflfcmdvdqvfqdkfgvetlgesvaqlqawwykadpndftye
    rrkesaayipfgegdfyyhaaifggtptqvlnitqecfkgilkdkkndieaqwhneshln
    kyfllnkptkilspeycwdyhiglpadiklvkmswqtkeynvvrnnv