PDB entry 2vrx

View 2vrx on RCSB PDB site
Description: structure of aurora b kinase in complex with zm447439
Class: cell cycle/transferase
Keywords: serine/threonine-protein kinase, kinase, nucleus, mitosis, magnesium, cell cycle/transferase, centromere, microtubule, ATP-binding, transferase, anti-cancer drug target, phosphoprotein, protein kinase, nucleotide-binding, coiled coil, cell division, metal-binding
Deposited on 2008-04-16, released 2008-07-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.191
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase 12-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vrxa_
  • Chain 'B':
    Compound: serine/threonine-protein kinase 12-a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2vrxb_
  • Chain 'C':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: inner centromere protein a
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: 447, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vrxA (A:)
    ntalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegveh
    qlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatf
    meeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldyl
    ppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgs
    kdliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vrxA (A:)
    kftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehqlrreieiqs
    hlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeeladalhy
    cherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemiegkth
    dekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdliskllry
    hppqrlplkgvmehpwvkansrrvlppvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vrxB (B:)
    ntalaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegveh
    qlrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatf
    meeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldyl
    ppemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgs
    kdliskllryhppqrlplkgvmehpwvkansrrvlppvyqstqsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vrxB (B:)
    ntalaempkrkftiddfdigrplggnvylarekqnkfimalkvlfksqlekegvehqlrr
    eieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeel
    adalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppem
    iegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdli
    skllryhppqrlplkgvmehpwvkansrrvlppvy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.