PDB entry 2vrp

View 2vrp on RCSB PDB site
Description: structure of rhodocytin
Class: sugar-binding protein
Keywords: c-type lectin-like, sugar-binding protein, lectin, clec-2, venom, aggretin
Deposited on 2008-04-09, released 2008-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: 0.204
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aggretin alpha chain
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vrpa_
  • Chain 'B':
    Compound: Aggretin beta chain
    Species: Calloselasma rhodostoma [TaxId:8717]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vrpb_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vrpA (A:)
    gledcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisq
    kdeladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvn
    yyceqmhafvckllpy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vrpA (A:)
    dcdfgwspydqhcyqafneqktwdeaekfcraqengahlasiesngeadfvswlisqkde
    ladedyvwiglraqnkeqqcssewsdgssvsyenlidlhtkkcgalekltgfrkwvnyyc
    eqmhafvckllpy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vrpB (B:)
    dcpsgwssyeghcykpfnepknwadaerfcklqpkhshlvsfqsaeeadfvvkltrprlk
    anlvwmglsniwhgcnwqwsdgarlnykdwqeqseclafrgvhtewlnmdcsstcsfvck
    fka