PDB entry 2vrd

View 2vrd on RCSB PDB site
Description: the structure of the zinc finger from the human spliceosomal protein u1c
Class: nuclear protein
Keywords: RNA-binding protein, structural genomics, riken structural genomics/proteomics initiative, spliceosomal protein, phosphoprotein, nuclear protein, ribonucleoprotein, zinc-finger, zinc finger, metal-binding, zinc, rsgi, nucleus, u1 snrnp, RNA-binding
Deposited on 2008-03-31, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: u1 small nuclear ribonucleoprotein c
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2vrda1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vrdA (A:)
    mpkfycdycdtylthdspsvrkthcsgrkhkenvkdyyqkwmeeqaqslidkttaafqqg
    k