PDB entry 2vr8
View 2vr8 on RCSB PDB site
Description: crystal structure of g85r als mutant of human cu,zn superoxide dismutase (cuznsod) at 1.36 a resolution
Class: oxidoreductase
Keywords: zinc, copper, human cu, cytoplasm, acetylation, ubl conjugation, disease mutation, zn superoxide dismutase, amyotrophic lateral sclerosis, antioxidant, metal-binding, oxidoreductase
Deposited on
2008-03-28, released
2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.115
AEROSPACI score: 0.77
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Superoxide dismutase [Cu-Zn]
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VR8
- Uniprot P00441 (0-152)
Domains in SCOPe 2.08: d2vr8a_ - Chain 'F':
Compound: Superoxide dismutase [Cu-Zn]
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- PDB 2VR8
- Uniprot P00441 (0-152)
Domains in SCOPe 2.08: d2vr8f_ - Heterogens: CU, ZN, SO4, SCN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>2vr8A (A:)
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq
- Chain 'F':
Sequence; same for both SEQRES and ATOM records: (download)
>2vr8F (F:)
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq