PDB entry 2vr8

View 2vr8 on RCSB PDB site
Description: crystal structure of g85r als mutant of human cu,zn superoxide dismutase (cuznsod) at 1.36 a resolution
Class: oxidoreductase
Keywords: zinc, copper, human cu, cytoplasm, acetylation, ubl conjugation, disease mutation, zn superoxide dismutase, amyotrophic lateral sclerosis, antioxidant, metal-binding, oxidoreductase
Deposited on 2008-03-28, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.36 Å
R-factor: 0.115
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VR8
      • engineered mutation (84)
    • Uniprot P00441 (0-152)
    Domains in SCOPe 2.08: d2vr8a_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VR8
      • engineered mutation (84)
    • Uniprot P00441 (0-152)
    Domains in SCOPe 2.08: d2vr8f_
  • Heterogens: CU, ZN, SO4, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2vr8A (A:)
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2vr8F (F:)
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq