PDB entry 2vr7

View 2vr7 on RCSB PDB site
Description: crystal structure of g85r als mutant of human cu,zn superoxide dismutase (cuznsod) at 1.58 a resolution
Class: oxidoreductase
Keywords: oxidoreductase, zinc, copper, human cu, cytoplasm, acetylation, ubl conjugation, disease mutation, zn superoxide dismutase, amyotrophic lateral sclerosis, antioxidant, metal-binding
Deposited on 2008-03-28, released 2008-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.137
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VR7
      • engineered mutation (84)
    • Uniprot P00441 (0-152)
    Domains in SCOPe 2.08: d2vr7a_
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VR7
      • engineered mutation (84)
    • Uniprot P00441 (0-152)
    Domains in SCOPe 2.08: d2vr7f_
  • Heterogens: CU, ZN, SO4, SCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vr7A (A:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2vr7F (F:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
    gphfnplsrkhggpkdeerhvgdlrnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlacgvigiaq