PDB entry 2vqc

View 2vqc on RCSB PDB site
Description: structure of a DNA binding winged-helix protein, f-112, from sulfolobus spindle-shaped virus 1.
Class: DNA-binding protein
Keywords: ssv, winged-helix, crenarchaeal, DNA-binding protein, thermophilic protein, sulfolobus spindle virus
Deposited on 2008-03-12, released 2008-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.175
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 13.2 kda protein
    Species: SULFOLOBUS VIRUS-LIKE PARTICLE SSV1 [TaxId:244589]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vqca1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vqcA (A:)
    mhhhhhhaqtlnsykmaeimykilekkgeltledilaqfeisvpsayniqralkaicerh
    pdecevqyknrkttfkwikqeqkeeqkqeqtqdniakifdaqpanfeqtdqgfikakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vqcA (A:)
    tlnsykmaeimykilekkgeltledilaqfeisvpsayniqralkaicerhpdecevqyk
    nrkttfkwik