PDB entry 2vpl
View 2vpl on RCSB PDB site
Description: the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii
Deposited on
2008-03-01, released
2008-09-23
The last revision was dated
2019-07-24, with a file datestamp of
2019-07-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: 50s ribosomal protein l1
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: fragment of mRNA for l1-operon containing regulator l1-binding site
Species: Methanocaldococcus jannaschii [TaxId:2190]
- Chain 'C':
Compound: 50s ribosomal protein l1
Species: Thermus thermophilus [TaxId:274]
Database cross-references and differences (RAF-indexed):
- Chain 'D':
Compound: fragment of mRNA for l1-operon containing regulator l1-binding site
Species: Methanocaldococcus jannaschii [TaxId:2190]
- Heterogens: K, HOH
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
- Chain 'A':
Sequence; same for both SEQRES and ATOM records:
>2vplA (A:)
pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
tvslphggriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrs
vyvtttmgpsvrinphs
- Chain 'B':
No sequence available.
- Chain 'C':
Sequence; same for both SEQRES and ATOM records:
>2vplC (C:)
pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
tvslphggriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrs
vyvtttmgpsvrinphs
- Chain 'D':
No sequence available.