PDB entry 2vpl

View 2vpl on RCSB PDB site
Description: the structure of the complex between the first domain of l1 protein from thermus thermophilus and mrna from methanococcus jannaschii
Deposited on 2008-03-01, released 2008-09-23
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: fragment of mRNA for l1-operon containing regulator l1-binding site
    Species: Methanocaldococcus jannaschii [TaxId:2190]
  • Chain 'C':
    Compound: 50s ribosomal protein l1
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: fragment of mRNA for l1-operon containing regulator l1-binding site
    Species: Methanocaldococcus jannaschii [TaxId:2190]
  • Heterogens: K, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >2vplA (A:)
    pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
    tvslphggriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrs
    vyvtttmgpsvrinphs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >2vplC (C:)
    pkhgkryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrg
    tvslphggriefrndktgaihapvgkasfppekladnirafiraleahkpegakgtflrs
    vyvtttmgpsvrinphs
    

  • Chain 'D':
    No sequence available.