PDB entry 2vpk

View 2vpk on RCSB PDB site
Description: Crystal structure of the BTB domain of human myoneurin
Class: transcription
Keywords: transcription regulation, transcription, metal-binding, nucleus, btb domain, zinc-finger, DNA-binding
Deposited on 2008-02-29, released 2008-03-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1981
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myoneurin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NPC7 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.03: d2vpka_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vpkA (A:)
    smshhcehllerlnkqreagflcdctivigefqfkahrnvlasfseyfgaiyrstsennv
    fldqsqvkadgfqkllefiytgtlnldswnvkeihqaadylkveevvtkckikmed
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vpkA (A:)
    smshhcehllerlnkqreagflcdctivigefqfkahrnvlasfseyfgaiyrstsennv
    fldqsqvkadgfqkllefiytgtlnldswnvkeihqaadylkveevvtkckikme