PDB entry 2vph

View 2vph on RCSB PDB site
Description: crystal structure of the human protein tyrosine phosphatase, non-receptor type 4, pdz domain
Class: hydrolase
Keywords: protein phosphatase, ptpn4, ptpmeg, hydrolase, cytoskeleton, megakaryocyte, dephosphorylation, structural protein
Deposited on 2008-02-29, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.21
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPH (96-99)
    • Uniprot P29074 (2-95)
    Domains in SCOPe 2.07: d2vpha_
  • Chain 'B':
    Compound: tyrosine-protein phosphatase non-receptor type 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPH (96-99)
    • Uniprot P29074 (2-95)
    Domains in SCOPe 2.07: d2vphb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vphA (A:)
    smdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlin
    grdiaehthdqvvlfikascerhsgelmllvrpnavestv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vphA (A:)
    dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
    diaehthdqvvlfikascerhsgelmllvrpnavestv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vphB (B:)
    smdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlin
    grdiaehthdqvvlfikascerhsgelmllvrpnavestv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vphB (B:)
    mdnlvlirmkpdngrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
    diaehthdqvvlfikaselmllvrpnavestv