PDB entry 2vph

View 2vph on RCSB PDB site
Description: Crystal structure of the human protein tyrosine phosphatase, non- receptor type 4, PDZ domain
Class: hydrolase
Keywords: protein phosphatase, ptpn4, ptpmeg, hydrolase, cytoskeleton, megakaryocyte, dephosphorylation, structural protein
Deposited on 2008-02-29, released 2008-03-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tyrosine-protein phosphatase non-receptor type 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPH (96-99)
    • Uniprot P29074 (2-95)
    Domains in SCOPe 2.08: d2vpha1, d2vpha2
  • Chain 'B':
    Compound: tyrosine-protein phosphatase non-receptor type 4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPH (96-99)
    • Uniprot P29074 (2-95)
    Domains in SCOPe 2.08: d2vphb1, d2vphb2, d2vphb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2vphA (A:)
smdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlin
grdiaehthdqvvlfikascerhsgelmllvrpnavestv

    Sequence, based on observed residues (ATOM records): (download) 
    >2vphA (A:)
dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
diaehthdqvvlfikascerhsgelmllvrpnavestv

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >2vphB (B:)
smdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlin
grdiaehthdqvvlfikascerhsgelmllvrpnavestv

    Sequence, based on observed residues (ATOM records): (download) 
    >2vphB (B:)
mdnlvlirmkpdngrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
diaehthdqvvlfikaselmllvrpnavestv