PDB entry 2vpd

View 2vpd on RCSB PDB site
Description: decoding of methylated histone h3 tail by the pygo-bcl9 wnt signaling complex
Deposited on 2008-02-27, released 2008-06-17
The last revision was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 2.77 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pygopus homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPD
    • Uniprot Q9Y3Y4 (Start-66)
  • Chain 'B':
    Compound: b-cell cll/lymphoma 9 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPD (Start-2)
    • Uniprot O00512 (3-34)
  • Chain 'C':
    Compound: Pygopus homolog 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPD (0-0)
    • Uniprot Q9Y3Y4 (1-End)
  • Chain 'D':
    Compound: b-cell cll/lymphoma 9 protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPD (0-2)
    • Uniprot O00512 (3-34)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >2vpdA (A:)
    mghsssdpvypcgictnevnddqdailceascqkwfhrictgmtetayglltaeasavwg
    cdtcmad
    

    Sequence, based on observed residues (ATOM records):
    >2vpdA (A:)
    vypcgictnevnddqdailceascqkwfhrictgmtetayglltaeasavwgcdtcmad
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >2vpdB (B:)
    amaakvvyvfstemankaaeavlkgqvetivsfhi
    

    Sequence, based on observed residues (ATOM records):
    >2vpdB (B:)
    maakvvyvfstemankaaeavlkgqvetivsfhi
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >2vpdC (C:)
    mghsssdpvypcgictnevnddqdailceascqkwfhrictgmtetayglltaeasavwg
    cdtcmad
    

    Sequence, based on observed residues (ATOM records):
    >2vpdC (C:)
    mghsssdpvypcgictnevnddqdailceascqkwfhrictgmtetayglltaeasavwg
    cdtcma
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >2vpdD (D:)
    amaakvvyvfstemankaaeavlkgqvetivsfhi