PDB entry 2vpa

View 2vpa on RCSB PDB site
Description: high resolution crystal structure of the antibiotic resistance protein nima from deinococcus radiodurans
Class: oxidoreductase
Keywords: cofactor, atomic resolution, antibiotic resistance, deinococcus radiodurans, oxidoreductase
Deposited on 2008-02-27, released 2008-08-19
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.142
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nima-related protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VPA
    • Uniprot Q9RW27 (Start-215)
    Domains in SCOPe 2.02: d2vpaa_
  • Heterogens: ACT, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vpaA (A:)
    msyyhhhhhhlestslykkagmsdfydprerdpsvsrrpqnrqsdewirelllrgtiarv
    atlwqgedgaafpfitplayayrpeqgdlvyhtnvvgrlranagqghpatlevseigqfl
    psnsplelsvqyrsvmvfgtarvlagedaraalttlservfpglkvgettrpiseddlkr
    tsvyslsidrwsgkenwaeqaiqeedwpalgpewlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vpaA (A:)
    syyhhhhhhlsdfydprerdpsvsrrpqnrqsdewirelllrgtiarvatlwqgedgaaf
    pfitplayayrpeqgdlvyhtnvvgrlranagqghpatlevseigqflpsnsplelsvqy
    rsvmvfgtarvlagedaraalttlservfpglkvgettrpiseddlkrtsvyslsidrws
    gkenwaeqaiqeedwpalgpewlg