PDB entry 2voo

View 2voo on RCSB PDB site
Description: crystal structure of n-terminal domains of human la protein complexed with RNA oligomer uuuuuuuu
Class: RNA-binding protein
Keywords: RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation, RNA binding protein, nucleus, la motif, RNA-binding, polymorphism
Deposited on 2008-02-19, released 2008-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.25
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vooa1, d2vooa2
  • Chain 'B':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2voob1, d2voob2
  • Chain 'C':
    Compound: 5'-r(*up*up*up*up*up*up*up)-3'
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'D':
    Compound: 5'-r(*up*up*up*up*up*up*up)-3'
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vooA (A:)
    gsngdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrl
    ttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptd
    atlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdll
    ilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vooA (A:)
    maaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdfnviv
    ealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatlddike
    wledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilfkddy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vooB (B:)
    gsngdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrl
    ttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptd
    atlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdll
    ilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vooB (B:)
    kmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdfnvi
    vealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatlddik
    ewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilfk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.