PDB entry 2vol

View 2vol on RCSB PDB site
Description: Murine TRIM21 in Complex with Murine IgG Fc
Class: immune system
Keywords: fc, b30.2, ro.52, nucleus, pryspry, mouse igg, zinc-finger, DNA-binding, RNA-binding, tripartite motif (trim) protein, spry systemic lupus erythematosus, immune system, metal-binding, ribonucleoprotein, systemic lupus erythematosus
Deposited on 2008-02-19, released 2008-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.231
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: murine igg fc
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VOL (0-206)
    Domains in SCOPe 2.07: d2vola1, d2vola2
  • Chain 'B':
    Compound: 52 kda ro protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VOL (0-1)
      • conflict (100)
    • Uniprot Q62191 (2-179)
    Domains in SCOPe 2.07: d2volb1, d2volb2
  • Heterogens: FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2volA (A:)
    vssvfifppkpkdvltitltpkvtcvvvdiskddpevqfswfvddvevhtaqtkpreeqf
    nstfrsvselpimhqdwlngkefkcrvnsaafpapiektisktkgrpkapqvytlpppke
    qmakdkvsltcmitdffpeditvewesngqpaenykntqpimdtdgsyfvysklnvqksn
    weagntftcsvlheglhnhhtekslsh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2volB (B:)
    hmvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmyw
    evdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppc
    qigifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl