PDB entry 2voi

View 2voi on RCSB PDB site
Description: structure of mouse a1 bound to the bid bh3-domain
Class: apoptosis
Keywords: protein-protein complex, bh3, bcl-2, membrane, apoptosis, pro-survival, mitochondrion, phosphoprotein
Deposited on 2008-02-17, released 2008-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2-related protein a1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VOI (Start-4)
      • engineered mutation (108)
      • engineered mutation (117)
    • Uniprot Q07440 (5-End)
    Domains in SCOPe 2.08: d2voia1, d2voia2
  • Chain 'B':
    Compound: bh3-interacting domain death agonist p13
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2voiA (A:)
    gplgsmaeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksy
    lddfhvesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsay
    kqvssfvaefimnntgewirqnggwedgfikkfepks
    

    Sequence, based on observed residues (ATOM records): (download)
    >2voiA (A:)
    smaeselmhihslaehylqyvlqvpafesapsqacrvlqrvafsvqkeveknlksylddf
    hvesidtariifnqvmekefedgiinwgrivtifafggvllkklkqeqialdvsaykqvs
    sfvaefimnntgewirqnggwedgfikkfe
    

  • Chain 'B':
    No sequence available.