PDB entry 2vod

View 2vod on RCSB PDB site
Description: crystal structure of n-terminal domains of human la protein complexed with RNA oligomer auauuuu
Class: RNA-binding protein
Keywords: RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation, RNA-binding protein, nucleus, la motif, RNA-binding, polymorphism
Deposited on 2008-02-15, released 2008-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.232
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2voda1, d2voda2
  • Chain 'B':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2vodb1, d2vodb2
  • Chain 'C':
    Compound: 5'-r(*ap*up*ap*up*up*up*up)-3'
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Chain 'D':
    Compound: 5'-r(*ap*up*ap*up*up*up*up)-3'
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vodA (A:)
    gsngdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrl
    ttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptd
    atlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdll
    ilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vodA (A:)
    dnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttdf
    nvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatld
    dikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilfk
    ddyfakk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vodB (B:)
    gsngdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrl
    ttdfnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptd
    atlddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdll
    ilfkddyfakkne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vodB (B:)
    gdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnrlttd
    fnvivealskskaelmeisedktkirrspskplpevtdeykndvknrsvyikgfptdatl
    ddikewledkgqvlniqmrrtlhkafkgsifvvfdsiesakkfvetpgqkyketdllilf
    kddyfakk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.