SCOPe 2.07: Structural Classification of Proteins

PDB entry 2vo8

View 2vo8 on RCSB PDB site
Description: Cohesin module from Clostridium perfringens ATCC13124 family 33 glycoside hydrolase.
Class: hydrolase
Keywords: hydrolase, cohesin, high affinity, glycoside hydrolase, clostridium perfringens
Deposited on 2008-02-08, released 2008-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: exo-alpha-sialidase
Species: Clostridium perfringens [TaxId:1502]
Database cross-references and differences (RAF-indexed):
- Uniprot Q0TTQ4
Domains in SCOPe 2.07: d2vo8a1
Heterogens: HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>2vo8A (A:)
qigelkttvgnstikvndevqvgsafeailgieglngdtevysaeylfeynaeafilnei
tsfndslfvkskevepgkvrilvaslgneiekdsdlvkvnltpkisselevlglttalvg
agdgnthdlelsskevkineeas

Sequence, based on observed residues (ATOM records): (download)

>2vo8A (A:)
ttvgnstikvndevqvgsafeailgieglngdtevysaeylfeynaeafilneitsfnds
lfvkskevepgkvrilvaslgneiekdsdlvkvnltpkisselevlglttalvgagdgnt
hdlelsskevkineea