PDB entry 2vo1

View 2vo1 on RCSB PDB site
Description: crystal structure of the synthetase domain of human ctp synthetase
Class: ligase
Keywords: pyrimidine biosynthesis, glutamine amidotransferase, phosphorylation, amidotransferase, cytidine 5-prime triphosphate synthetase, ctp, utp, ctps, ligase, glutamine, ctp synthase, phosphoprotein, ctp synthetase
Deposited on 2008-02-08, released 2008-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.204
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ctp synthase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VO1 (Start-21)
    • Uniprot P17812 (22-294)
    Domains in SCOPe 2.06: d2vo1a1, d2vo1a2
  • Chain 'B':
    Compound: ctp synthase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VO1 (Start-21)
    • Uniprot P17812 (22-294)
    Domains in SCOPe 2.06: d2vo1b2, d2vo1b3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vo1A (A:)
    mhhhhhhssgvdlgtenlyfqsmkyilvtggvisgigkgiiassvgtilkscglhvtsik
    idpyinidagtfspyehgevfvlddggevdldlgnyerfldirltkdnnlttgkiyqyvi
    nkerkgdylgktvqvvphitdaiqewvmrqalipvdedglepqvcvielggtvgdiesmp
    fieafrqfqfkvkrenfcnihvslvpqpsstgeqktkptqnsvrelrglglspdlvvcrc
    snpldtsvkekismfchvepeqvicvhdvssiyrvpllleeqgvvdyflrrldlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vo1A (A:)
    qsmkyilvtggvisgigkgiiassvgtilkscglhvtsikidpyinidnnlttgkiyqyv
    inkerkgdylgktvqvvphitdaiqewvmrqalipvdedglepqvcvielggtvgdiesm
    pfieafrqfqfkvkrenfcnihvslvpqpssgeqktkptqnsvrelrglglspdlvvcrc
    snpldtsvkekismfchvepeqvicvhdvssiyrvpllleeqgvvdyflrrldlp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2vo1B (B:)
    mhhhhhhssgvdlgtenlyfqsmkyilvtggvisgigkgiiassvgtilkscglhvtsik
    idpyinidagtfspyehgevfvlddggevdldlgnyerfldirltkdnnlttgkiyqyvi
    nkerkgdylgktvqvvphitdaiqewvmrqalipvdedglepqvcvielggtvgdiesmp
    fieafrqfqfkvkrenfcnihvslvpqpsstgeqktkptqnsvrelrglglspdlvvcrc
    snpldtsvkekismfchvepeqvicvhdvssiyrvpllleeqgvvdyflrrldlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vo1B (B:)
    smkyilvtggvisgigkgiiassvgtilkscglhvtsikidpyinidnlttgkiyqyvin
    kerkgdylgktvqvvphitdaiqewvmrqalipglepqvcvielggtvgdiesmpfieaf
    rqfqfkvkrenfcnihvslvpqpsgeqktkptqnsvrelrglglspdlvvcrcsnpldts
    vkekismfchvepeqvicvhdvssiyrvpllleeqgvvdyflrrldlp